CELF6 Antikörper

Produktnummer ABIN633299

Produktdetails anti-CELF6 Antikörper

Target: CELF6 (CUGBP, Elav-Like Family Member 6 (CELF6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CELF6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: BRUNOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BRUNOL6 Blocking Peptide, catalog no. 33R-7452, is also available for use as a blocking control in assays to test for specificity of this BRUNOL6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CELF6

Target: CELF6 (CUGBP, Elav-Like Family Member 6 (CELF6))

Andere Bezeichnung: BRUNOL6 (CELF6 Produkte)

Synonyme: BRUNOL6 antikoerper, 6330569O16Rik antikoerper, Brunol6 antikoerper, CUGBP Elav-like family member 6 antikoerper, CUGBP, Elav-like family member 6 antikoerper, CELF6 antikoerper, Celf6 antikoerper

Hintergrund: BRUNOL6 is a RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing. It mediates exon inclusion and/or exclusion in pre-mRNAs that are subject to tissue-specific and developmentally regulated alternative splicing. BRUNOL6 specifically activates exon 5 inclusion of TNNT2 in a muscle-specific splicing enhancer (MSE)-dependent manner. It also promotes exon exclusion of INSR pre-mRNA.

Molekulargewicht: 50 kDa (MW of target protein)