SEPSECS Antikörper (N-Term)

Produktnummer ABIN633298

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SEPSECS in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für SEPSECS Antikörper (N-Term) (ABIN633298)

Target: SEPSECS (Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA Synthase (SEPSECS))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SEPSECS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SEPSECS Antikörper

Bindungsspezifität: N-Term

Spezifität: SLA/LP antibody was raised against the N terminal of SLA/LP

Produktmerkmale: Rabbit polyclonal SLA/LP antibody raised against the N terminal of SLA/LP

Aufreinigung: Affinity purified

Immunogen: SLA/LP antibody was raised using the N terminal of SLA/LP corresponding to a region with amino acids MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLA/LP Blocking Peptide, (ABIN5616165), is also available for use as a blocking control in assays to test for specificity of this SLA/LP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLA/LP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SEPSECS

Target: SEPSECS (Sep (O-phosphoserine) tRNA:Sec (Selenocysteine) tRNA Synthase (SEPSECS))

Andere Bezeichnung: SLA/LP

Substanzklasse: Antibody

Hintergrund: SLA/LP converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom