JAKMIP1 Antikörper (Middle Region)

Produktnummer ABIN633295

Produktdetails anti-JAKMIP1 Antikörper

Target: JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser JAKMIP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: JAKMIP1 antibody was raised against the middle region of JAKMIP1

Aufreinigung: Affinity purified

Immunogen: JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

JAKMIP1 Blocking Peptide, catalog no. 33R-2981, is also available for use as a blocking control in assays to test for specificity of this JAKMIP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAKMIP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu JAKMIP1

Target: JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))

Andere Bezeichnung: JAKMIP1 (JAKMIP1 Produkte)

Synonyme: MGC81051 antikoerper, Gababrbp antikoerper, JAMIP1 antikoerper, MARLIN1 antikoerper, 5830437M04Rik antikoerper, C330021K24Rik antikoerper, Marlin-1 antikoerper, janus kinase and microtubule interacting protein 1 antikoerper, janus kinase and microtubule interacting protein 1 L homeolog antikoerper, janus kinase and microtubule-interacting protein 1 antikoerper, Celf_2690 antikoerper, JAKMIP1 antikoerper, jakmip1.L antikoerper, LOC100070079 antikoerper, jakmip1 antikoerper, LOC100432594 antikoerper, Jakmip1 antikoerper

Hintergrund: JAKMIP1 associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-B receptor. It may play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements.

Molekulargewicht: 97 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom