SRSF3 Antikörper (N-Term)

Produktnummer ABIN633291

Produktdetails anti-SRSF3 Antikörper

Target: SRSF3 (serine/arginine-Rich Splicing Factor 3 (SRSF3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRSF3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SFRS3 antibody was raised against the N terminal of SFRS3

Aufreinigung: Affinity purified

Immunogen: SFRS3 antibody was raised using the N terminal of SFRS3 corresponding to a region with amino acids SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS3 Blocking Peptide, catalog no. 33R-8935, is also available for use as a blocking control in assays to test for specificity of this SFRS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRSF3

Target: SRSF3 (serine/arginine-Rich Splicing Factor 3 (SRSF3))

Andere Bezeichnung: SFRS3 (SRSF3 Produkte)

Synonyme: SFRS3 antikoerper, SRp20 antikoerper, AL024116 antikoerper, Sfrs3 antikoerper, X16 antikoerper, sfrs3 antikoerper, srp20 antikoerper, SRP20 antikoerper, si:zc263a23.9 antikoerper, zgc:86626 antikoerper, serine and arginine rich splicing factor 3 antikoerper, serine/arginine-rich splicing factor 3 antikoerper, serine/arginine-rich splicing factor 3 S homeolog antikoerper, serine/arginine-rich splicing factor 3a antikoerper, SRSF3 antikoerper, Srsf3 antikoerper, srsf3.S antikoerper, srsf3a antikoerper

Hintergrund: SFRS3 belongs to the splicing factor SR family. It contains 1 RRM (RNA recognition motif) domain. It may be involved in RNA processing in relation with cellular proliferation and/or maturation.

Molekulargewicht: 19 kDa (MW of target protein)