SRSF3 Antikörper (N-Term)

Produktnummer ABIN633291

Dieses Anti-SRSF3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SRSF3 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für SRSF3 Antikörper (N-Term) (ABIN633291)

Target: SRSF3 (serine/arginine-Rich Splicing Factor 3 (SRSF3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRSF3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SRSF3 Antikörper

Bindungsspezifität: N-Term

Spezifität: SFRS3 antibody was raised against the N terminal of SFRS3

Aufreinigung: Affinity purified

Immunogen: SFRS3 antibody was raised using the N terminal of SFRS3 corresponding to a region with amino acids SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS3 Blocking Peptide, (ABIN5616101), is also available for use as a blocking control in assays to test for specificity of this SFRS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRSF3

Target: SRSF3 (serine/arginine-Rich Splicing Factor 3 (SRSF3))

Andere Bezeichnung: SFRS3

Hintergrund: SFRS3 belongs to the splicing factor SR family. It contains 1 RRM (RNA recognition motif) domain. It may be involved in RNA processing in relation with cellular proliferation and/or maturation.

Molekulargewicht: 19 kDa (MW of target protein)