RPL3 Antikörper (C-Term)

Produktnummer ABIN633286

Produktdetails anti-RPL3 Antikörper

Target: RPL3 (Ribosomal Protein L3 (RPL3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPL3 antibody was raised against the C terminal of RPL3

Aufreinigung: Affinity purified

Immunogen: RPL3 antibody was raised using the C terminal of RPL3 corresponding to a region with amino acids YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL3 Blocking Peptide, catalog no. 33R-10124, is also available for use as a blocking control in assays to test for specificity of this RPL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL3

Target: RPL3 (Ribosomal Protein L3 (RPL3))

Andere Bezeichnung: RPL3 (RPL3 Produkte)

Synonyme: ASC-1 antikoerper, L3 antikoerper, TARBP-B antikoerper, F2 antikoerper, J1 antikoerper, wu:fa99g02 antikoerper, wu:fb65e09 antikoerper, zgc:110350 antikoerper, CG4863 antikoerper, Dmel\\CG4863 antikoerper, Rpl3 antikoerper, anon-EST:GressD4 antikoerper, rpL3 antikoerper, ribosomal protein L3 antikoerper, 60S ribosomal protein L3 antikoerper, ribosomal protein L3 L homeolog antikoerper, 50S ribosomal protein L3 antikoerper, Ribosomal protein L3 antikoerper, RPL3 antikoerper, Rpl3 antikoerper, rpl-3 antikoerper, rpl3 antikoerper, rpl3.L antikoerper, RpL3 antikoerper

Hintergrund: Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation.

Molekulargewicht: 40 kDa (MW of target protein)