RPL3 Antikörper (C-Term)
-
- Target Alle RPL3 Antikörper anzeigen
- RPL3 (Ribosomal Protein L3 (RPL3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPL3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPL3 antibody was raised against the C terminal of RPL3
- Aufreinigung
- Affinity purified
- Immunogen
- RPL3 antibody was raised using the C terminal of RPL3 corresponding to a region with amino acids YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY
- Top Product
- Discover our top product RPL3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPL3 Blocking Peptide, catalog no. 33R-10124, is also available for use as a blocking control in assays to test for specificity of this RPL3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPL3 (Ribosomal Protein L3 (RPL3))
- Andere Bezeichnung
- RPL3 (RPL3 Produkte)
- Synonyme
- ASC-1 antikoerper, L3 antikoerper, TARBP-B antikoerper, F2 antikoerper, J1 antikoerper, wu:fa99g02 antikoerper, wu:fb65e09 antikoerper, zgc:110350 antikoerper, CG4863 antikoerper, Dmel\\CG4863 antikoerper, Rpl3 antikoerper, anon-EST:GressD4 antikoerper, rpL3 antikoerper, ribosomal protein L3 antikoerper, 60S ribosomal protein L3 antikoerper, ribosomal protein L3 L homeolog antikoerper, 50S ribosomal protein L3 antikoerper, Ribosomal protein L3 antikoerper, RPL3 antikoerper, Rpl3 antikoerper, rpl-3 antikoerper, rpl3 antikoerper, rpl3.L antikoerper, RpL3 antikoerper
- Hintergrund
- Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation.
- Molekulargewicht
- 40 kDa (MW of target protein)
-