Pre-mRNA Branch Site Protein p14 (SF3B14) (N-Term) Antikörper

Produktnummer ABIN633279

Dieses Anti--Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von in WB. Geeignet für Human und Maus.

Kurzübersicht für Pre-mRNA Branch Site Protein p14 (SF3B14) (N-Term) Antikörper (ABIN633279)

Target: Pre-mRNA Branch Site Protein p14 (SF3B14)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: N-Term

Spezifität: SF3 B14 antibody was raised against the N terminal of SF3 14

Aufreinigung: Affinity purified

Immunogen: SF3 B14 antibody was raised using the N terminal of SF3 14 corresponding to a region with amino acids MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SF3B14 Blocking Peptide, (ABIN5616089), is also available for use as a blocking control in assays to test for specificity of this SF3B14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Pre-mRNA Branch Site Protein p14 (SF3B14)

Andere Bezeichnung: SF3B14

Hintergrund: SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.

Molekulargewicht: 14 kDa (MW of target protein)