EXOSC2 Antikörper (Middle Region)

Produktnummer ABIN633278

Der Kaninchen Polyklonal Anti-EXOSC2-Antikörper wurde für WB validiert. Er ist geeignet, EXOSC2 in Proben von Human und Maus zu detektieren.

Kurzübersicht für EXOSC2 Antikörper (Middle Region) (ABIN633278)

Target: EXOSC2 (Exosome Component 2 (EXOSC2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EXOSC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EXOSC2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: EXOSC2 antibody was raised against the middle region of EXOSC2

Aufreinigung: Affinity purified

Immunogen: EXOSC2 antibody was raised using the middle region of EXOSC2 corresponding to a region with amino acids AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOSC2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this EXOSC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EXOSC2

Target: EXOSC2 (Exosome Component 2 (EXOSC2))

Andere Bezeichnung: EXOSC2

Hintergrund: EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom