KRR1 Antikörper (C-Term)

Produktnummer ABIN633275

Der Kaninchen Polyklonal Anti-KRR1-Antikörper wurde für WB validiert. Er ist geeignet, KRR1 in Proben von Human zu detektieren.

Kurzübersicht für KRR1 Antikörper (C-Term) (ABIN633275)

Target: KRR1 (KRR1, Small Subunit (SSU) Processome Component, Homolog (KRR1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KRR1 Antikörper

Bindungsspezifität: C-Term

Spezifität: KRR1 antibody was raised against the C terminal of KRR1

Aufreinigung: Affinity purified

Immunogen: KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KRR1 Blocking Peptide, (ABIN939639), is also available for use as a blocking control in assays to test for specificity of this KRR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KRR1

Target: KRR1 (KRR1, Small Subunit (SSU) Processome Component, Homolog (KRR1))

Andere Bezeichnung: KRR1

Hintergrund: KRR1 belongs to the KRR1 family. It contains 1 KH domain. KRR1 is required for 40S ribosome biogenesis. It is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.

Molekulargewicht: 44 kDa (MW of target protein)