ISG20 Antikörper (Middle Region)
-
- Target Alle ISG20 Antikörper anzeigen
- ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ISG20 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ISG20 antibody was raised against the middle region of ISG20
- Aufreinigung
- Affinity purified
- Immunogen
- ISG20 antibody was raised using the middle region of ISG20 corresponding to a region with amino acids TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM
- Top Product
- Discover our top product ISG20 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ISG20 Blocking Peptide, catalog no. 33R-9301, is also available for use as a blocking control in assays to test for specificity of this ISG20 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISG20 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))
- Andere Bezeichnung
- ISG20 (ISG20 Produkte)
- Synonyme
- ISG20 antikoerper, CD25 antikoerper, HEM45 antikoerper, 1600023I01Rik antikoerper, 2010107M23Rik antikoerper, 20kDa antikoerper, DnaQL antikoerper, interferon stimulated exonuclease gene 20 antikoerper, interferon-stimulated protein antikoerper, ISG20 antikoerper, Isg20 antikoerper
- Hintergrund
- ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.
- Molekulargewicht
- 20 kDa (MW of target protein)
-