ISG20 Antikörper (Middle Region)

Produktnummer ABIN633271

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ISG20 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für ISG20 Antikörper (Middle Region) (ABIN633271)

Target: ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ISG20 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ISG20 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ISG20 antibody was raised against the middle region of ISG20

Aufreinigung: Affinity purified

Immunogen: ISG20 antibody was raised using the middle region of ISG20 corresponding to a region with amino acids TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ISG20 Blocking Peptide, (ABIN5614218), is also available for use as a blocking control in assays to test for specificity of this ISG20 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISG20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ISG20

Target: ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))

Andere Bezeichnung: ISG20

Hintergrund: ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.

Molekulargewicht: 20 kDa (MW of target protein)