EXOSC3 Antikörper (Middle Region)

Produktnummer ABIN633267

Dieses Anti-EXOSC3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von EXOSC3 in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für EXOSC3 Antikörper (Middle Region) (ABIN633267)

Target: EXOSC3 (Exosome Component 3 (EXOSC3))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EXOSC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-EXOSC3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: EXOSC3 antibody was raised against the middle region of EXOSC3

Aufreinigung: Affinity purified

Immunogen: EXOSC3 antibody was raised using the middle region of EXOSC3 corresponding to a region with amino acids TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOSC3 Blocking Peptide, (ABIN5613433), is also available for use as a blocking control in assays to test for specificity of this EXOSC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EXOSC3

Target: EXOSC3 (Exosome Component 3 (EXOSC3))

Andere Bezeichnung: EXOSC3

Hintergrund: EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, SARS-CoV-2 Protein Interaktom