INTS6 Antikörper (C-Term)
Kurzübersicht für INTS6 Antikörper (C-Term) (ABIN633264)
Target
Alle INTS6 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- INTS6 antibody was raised against the C terminal of INTS6
-
Aufreinigung
- Affinity purified
-
Immunogen
- INTS6 antibody was raised using the C terminal of INTS6 corresponding to a region with amino acids GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
INTS6 Blocking Peptide, (ABIN938647), is also available for use as a blocking control in assays to test for specificity of this INTS6 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INTS6 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- INTS6 (Integrator Complex Subunit 6 (INTS6))
-
Andere Bezeichnung
- INTS6
-
Hintergrund
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. INTS6 is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH).
-
Molekulargewicht
- 99 kDa (MW of target protein)
Target
-