INTS6 Antikörper (C-Term)

Produktnummer ABIN633264

Dieses Anti-INTS6-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von INTS6 in WB. Geeignet für Human.

Kurzübersicht für INTS6 Antikörper (C-Term) (ABIN633264)

Target: INTS6 (Integrator Complex Subunit 6 (INTS6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser INTS6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-INTS6 Antikörper

Bindungsspezifität: C-Term

Spezifität: INTS6 antibody was raised against the C terminal of INTS6

Aufreinigung: Affinity purified

Immunogen: INTS6 antibody was raised using the C terminal of INTS6 corresponding to a region with amino acids GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

INTS6 Blocking Peptide, (ABIN938647), is also available for use as a blocking control in assays to test for specificity of this INTS6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INTS6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu INTS6

Target: INTS6 (Integrator Complex Subunit 6 (INTS6))

Andere Bezeichnung: INTS6

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. INTS6 is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH).

Molekulargewicht: 99 kDa (MW of target protein)