DHX15 Antikörper

Produktnummer ABIN633263

Der Kaninchen Polyklonal Anti-DHX15-Antikörper wurde für WB validiert. Er ist geeignet, DHX15 in Proben von Human, Maus, Ratte und Arabidopsis zu detektieren.

Kurzübersicht für DHX15 Antikörper (ABIN633263)

Target: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Reaktivität: Human, Maus, Ratte, Arabidopsis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHX15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DHX15 Antikörper

Aufreinigung: Affinity purified

Immunogen: DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHX15 Blocking Peptide, (ABIN936106), is also available for use as a blocking control in assays to test for specificity of this DHX15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHX15

Target: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Andere Bezeichnung: DHX15

Hintergrund: DHX15 is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.

Molekulargewicht: 91 kDa (MW of target protein)