SLIRP Antikörper (N-Term)

Produktnummer ABIN633258

Der Kaninchen Polyklonal anti-SLIRP Antikörper (ABIN633258) detektiert spezifisch SLIRP in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SLIRP Antikörper (N-Term) (ABIN633258)

Target: SLIRP (SRA Stem-Loop Interacting RNA Binding Protein (SLIRP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLIRP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLIRP Antikörper

Bindungsspezifität: N-Term

Spezifität: C14 ORF156 antibody was raised against the N terminal Of C14 rf156

Aufreinigung: Affinity purified

Immunogen: C14 ORF156 antibody was raised using the N terminal Of C14 rf156 corresponding to a region with amino acids PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF156 Blocking Peptide, (ABIN5612410), is also available for use as a blocking control in assays to test for specificity of this C14ORF156 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF156 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLIRP

Target: SLIRP (SRA Stem-Loop Interacting RNA Binding Protein (SLIRP))

Andere Bezeichnung: C14ORF156

Hintergrund: As a RNA-binding protein, C14orf156 acts as a nuclear receptor corepressor. It probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. C14orf156 binds the STR7 loop of SRA RNA. It is also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation.

Molekulargewicht: 12 kDa (MW of target protein)