DIS3 Antikörper

Produktnummer ABIN633251

Produktdetails anti-DIS3 Antikörper

Target: DIS3 (Exosome Complex Exonuclease RRP44 (DIS3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DIS3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DIS3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DIS3 Blocking Peptide, catalog no. 33R-2010, is also available for use as a blocking control in assays to test for specificity of this DIS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DIS3

Target: DIS3 (Exosome Complex Exonuclease RRP44 (DIS3))

Andere Bezeichnung: DIS3 (DIS3 Produkte)

Hintergrund: DIS3, belonging to the ribonuclease II (RNB) family, has a 3'-5' exonuclease activity. It is a catalytic component of the exosome 3'->5' exoribonuclease complex required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and for mRNA decay. The protein is implicated in mitotic control and essential for cell division and spore germination. It may be involved in regulating protein dephosphorylation during mitosis.

Molekulargewicht: 109 kDa (MW of target protein)