SMN1 Antikörper (N-Term)

Produktnummer ABIN633245

Der Kaninchen Polyklonal Anti-SMN1-Antikörper wurde für WB validiert. Er ist geeignet, SMN1 in Proben von Human und Hund zu detektieren.

Kurzübersicht für SMN1 Antikörper (N-Term) (ABIN633245)

Target: SMN1 (Survival of Motor Neuron 1, Telomeric (SMN1))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SMN1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SMN1 antibody was raised against the N terminal of SMN1

Aufreinigung: Affinity purified

Immunogen: SMN1 antibody was raised using the N terminal of SMN1 corresponding to a region with amino acids KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMN1 Blocking Peptide, (ABIN939647), is also available for use as a blocking control in assays to test for specificity of this SMN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMN1

Target: SMN1 (Survival of Motor Neuron 1, Telomeric (SMN1))

Andere Bezeichnung: SMN1

Hintergrund: SMN1 localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization