PNPT1 Antikörper (Middle Region)

Produktnummer ABIN633243

Der Kaninchen Polyklonal anti-PNPT1 Antikörper (ABIN633243) detektiert spezifisch PNPT1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für PNPT1 Antikörper (Middle Region) (ABIN633243)

Target: PNPT1 (Polyribonucleotide Nucleotidyltransferase 1 (PNPT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNPT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PNPT1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PNPT1 antibody was raised against the middle region of PNPT1

Aufreinigung: Affinity purified

Immunogen: PNPT1 antibody was raised using the middle region of PNPT1 corresponding to a region with amino acids CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNPT1 Blocking Peptide, (ABIN937084), is also available for use as a blocking control in assays to test for specificity of this PNPT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNPT1

Target: PNPT1 (Polyribonucleotide Nucleotidyltransferase 1 (PNPT1))

Andere Bezeichnung: PNPT1

Hintergrund: PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation.

Molekulargewicht: 86 kDa (MW of target protein)