SNRPD2 Antikörper (N-Term)

Produktnummer ABIN633239

Produktdetails anti-SNRPD2 Antikörper

Target: SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRPD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SNRPD2 antibody was raised against the N terminal of SNRPD2

Aufreinigung: Affinity purified

Immunogen: SNRPD2 antibody was raised using the N terminal of SNRPD2 corresponding to a region with amino acids MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRPD2 Blocking Peptide, catalog no. 33R-6463, is also available for use as a blocking control in assays to test for specificity of this SNRPD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRPD2

Target: SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))

Andere Bezeichnung: SNRPD2 (SNRPD2 Produkte)

Hintergrund: SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 13 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization