HNRNPAB Antikörper (N-Term)
-
- Target Alle HNRNPAB Antikörper anzeigen
- HNRNPAB (Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HNRNPAB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HNRPAB antibody was raised against the N terminal Of Hnrpab
- Aufreinigung
- Affinity purified
- Immunogen
- HNRPAB antibody was raised using the N terminal Of Hnrpab corresponding to a region with amino acids GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK
- Top Product
- Discover our top product HNRNPAB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HNRPAB Blocking Peptide, catalog no. 33R-3144, is also available for use as a blocking control in assays to test for specificity of this HNRPAB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPAB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPAB (Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB))
- Andere Bezeichnung
- HNRPAB (HNRNPAB Produkte)
- Synonyme
- fd36h02 antikoerper, wu:fd36h02 antikoerper, ABBP1 antikoerper, HNRPAB antikoerper, 3010025C11Rik antikoerper, CBF-A antikoerper, Cgbfa antikoerper, Hnrpab antikoerper, A1F-C1 antikoerper, hm:zeh1271 antikoerper, hnrpab antikoerper, wu:fa18g02 antikoerper, wu:fb07b06 antikoerper, wu:fb16c05 antikoerper, zeh1271 antikoerper, HNRNP A/B antikoerper, heterogeneous nuclear ribonucleoprotein A/Bb antikoerper, heterogeneous nuclear ribonucleoprotein A/B antikoerper, heterogeneous nuclear ribonucleoprotein A/Ba antikoerper, heterogeneous nuclear ribonucleoprotein A/B L homeolog antikoerper, hnrnpabb antikoerper, hnrnpab antikoerper, HNRNPAB antikoerper, Hnrnpab antikoerper, hnrnpaba antikoerper, hnrnpab.L antikoerper
- Hintergrund
- This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes.
- Molekulargewicht
- 36 kDa (MW of target protein)
-