HNRNPAB Antikörper (N-Term)

Produktnummer ABIN633238

Produktdetails anti-HNRNPAB Antikörper

Target: HNRNPAB (Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPAB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HNRPAB antibody was raised against the N terminal Of Hnrpab

Aufreinigung: Affinity purified

Immunogen: HNRPAB antibody was raised using the N terminal Of Hnrpab corresponding to a region with amino acids GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRPAB Blocking Peptide, catalog no. 33R-3144, is also available for use as a blocking control in assays to test for specificity of this HNRPAB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPAB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPAB

Target: HNRNPAB (Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB))

Andere Bezeichnung: HNRPAB (HNRNPAB Produkte)

Hintergrund: This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes.

Molekulargewicht: 36 kDa (MW of target protein)