HNRNPR Antikörper (N-Term)

Produktnummer ABIN633229

Produktdetails anti-HNRNPR Antikörper

Target: HNRNPR (Heterogeneous Nuclear Ribonucleoprotein R (HNRNPR))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HNRNPR antibody was raised against the N terminal of HNRNPR

Aufreinigung: Affinity purified

Immunogen: HNRNPR antibody was raised using the N terminal of HNRNPR corresponding to a region with amino acids ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRNPR Blocking Peptide, catalog no. 33R-1408, is also available for use as a blocking control in assays to test for specificity of this HNRNPR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRNPR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPR

Target: HNRNPR (Heterogeneous Nuclear Ribonucleoprotein R (HNRNPR))

Andere Bezeichnung: HNRNPR (HNRNPR Produkte)

Synonyme: hnrpr antikoerper, wu:fb97a09 antikoerper, wu:fe01h03 antikoerper, zgc:56523 antikoerper, HNRPR antikoerper, hnRNP R antikoerper, hnRNP-R antikoerper, 2610003J05Rik antikoerper, 2610528B01Rik antikoerper, Hnrpr antikoerper, heterogeneous nuclear ribonucleoprotein R antikoerper, hnrnpr antikoerper, HNRNPR antikoerper, Hnrnpr antikoerper

Hintergrund: HNRNPR belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Molekulargewicht: 71 kDa (MW of target protein)