HNRNPR Antikörper (N-Term)

Produktnummer ABIN633229

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch HNRNPR in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für HNRNPR Antikörper (N-Term) (ABIN633229)

Target: HNRNPR (Heterogeneous Nuclear Ribonucleoprotein R (HNRNPR))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HNRNPR Antikörper

Bindungsspezifität: N-Term

Spezifität: HNRNPR antibody was raised against the N terminal of HNRNPR

Aufreinigung: Affinity purified

Immunogen: HNRNPR antibody was raised using the N terminal of HNRNPR corresponding to a region with amino acids ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRNPR Blocking Peptide, (ABIN936794), is also available for use as a blocking control in assays to test for specificity of this HNRNPR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRNPR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPR

Target: HNRNPR (Heterogeneous Nuclear Ribonucleoprotein R (HNRNPR))

Andere Bezeichnung: HNRNPR

Hintergrund: HNRNPR belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Molekulargewicht: 71 kDa (MW of target protein)