HELLS Antikörper (Middle Region)

Produktnummer ABIN633220

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch HELLS in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für HELLS Antikörper (Middle Region) (ABIN633220)

Target: HELLS (Helicase, Lymphoid-Specific (HELLS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HELLS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HELLS Antikörper

Bindungsspezifität: Middle Region

Spezifität: HELLS antibody was raised against the middle region of HELLS

Aufreinigung: Affinity purified

Immunogen: HELLS antibody was raised using the middle region of HELLS corresponding to a region with amino acids QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HELLS Blocking Peptide, (ABIN5613983), is also available for use as a blocking control in assays to test for specificity of this HELLS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HELLS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HELLS

Target: HELLS (Helicase, Lymphoid-Specific (HELLS))

Andere Bezeichnung: HELLS

Hintergrund: HELLS is a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis.

Molekulargewicht: 92 kDa (MW of target protein)

Pathways: Chromatin Binding