HELLS Antikörper (Middle Region)
-
- Target Alle HELLS Antikörper anzeigen
- HELLS (Helicase, Lymphoid-Specific (HELLS))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HELLS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HELLS antibody was raised against the middle region of HELLS
- Aufreinigung
- Affinity purified
- Immunogen
- HELLS antibody was raised using the middle region of HELLS corresponding to a region with amino acids QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD
- Top Product
- Discover our top product HELLS Primärantikörper
-
anti-Helicase, Lymphoid-Specific (HELLS) antibody
HELLS Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Helicase, Lymphoid-Specific (HELLS) (AA 1-348) antibodyHELLS Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1D10 unconjugated
anti-Helicase, Lymphoid-Specific (HELLS) (AA 719-838) antibodyHELLS Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Helicase, Lymphoid-Specific (HELLS) (AA 550-600) antibodyHELLS Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Helicase, Lymphoid-Specific (HELLS) (AA 1-838) antibodyHELLS Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Helicase, Lymphoid-Specific (HELLS) (AA 1-838) antibodyHELLS Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Helicase, Lymphoid-Specific (HELLS) (AA 756-805) antibodyHELLS Reaktivität: Human, Kaninchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Helicase, Lymphoid-Specific (HELLS) (Middle Region) antibodyHELLS Reaktivität: Human, Maus, Ratte, Kaninchen, Pferd, Hund, Meerschweinchen, Rind (Kuh) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HELLS Blocking Peptide, catalog no. 33R-7725, is also available for use as a blocking control in assays to test for specificity of this HELLS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HELLS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HELLS (Helicase, Lymphoid-Specific (HELLS))
- Andere Bezeichnung
- HELLS (HELLS Produkte)
- Synonyme
- HELLS antikoerper, cb65 antikoerper, pasg antikoerper, sb:cb65 antikoerper, sb:cb749 antikoerper, im:6911667 antikoerper, AI323785 antikoerper, E130115I21Rik antikoerper, LSH antikoerper, Lysh antikoerper, PASG antikoerper, YFK8 antikoerper, Tbc1d12 antikoerper, SMARCA6 antikoerper, lsh antikoerper, nbla10143 antikoerper, smarca6 antikoerper, helicase, lymphoid-specific antikoerper, helicase, lymphoid specific antikoerper, helicase, lymphoid specific L homeolog antikoerper, HELLS antikoerper, hells antikoerper, Hells antikoerper, hells.L antikoerper
- Hintergrund
- HELLS is a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis.
- Molekulargewicht
- 92 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-
