SRP68 Antikörper (N-Term)

Produktnummer ABIN633214

Produktdetails anti-SRP68 Antikörper

Target: SRP68 (Signal Recognition Particle 68kDa (SRP68))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRP68 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SRP68 antibody was raised against the N terminal of SRP68

Aufreinigung: Affinity purified

Immunogen: SRP68 antibody was raised using the N terminal of SRP68 corresponding to a region with amino acids EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SRP68 Blocking Peptide, catalog no. 33R-2378, is also available for use as a blocking control in assays to test for specificity of this SRP68 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP68 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRP68

Target: SRP68 (Signal Recognition Particle 68kDa (SRP68))

Andere Bezeichnung: SRP68 (SRP68 Produkte)

Synonyme: 2610024I03Rik antikoerper, CG5064 antikoerper, Dmel\\CG5064 antikoerper, zgc:92573 antikoerper, Signal recognition particle 68kDa antikoerper, signal recognition particle 68 antikoerper, Signal recognition particle protein 68 antikoerper, signal recognition particle 68kDa L homeolog antikoerper, GL50803_8916 antikoerper, SRP68 antikoerper, Srp68 antikoerper, srp68 antikoerper, srp68.L antikoerper

Hintergrund: The signal recognition particle (SRP) is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. SRP68 is the 68kDa component of the SRP.

Molekulargewicht: 71 kDa (MW of target protein)