SLBP Antikörper

Produktnummer ABIN633212

Der Kaninchen Polyklonal Anti-SLBP-Antikörper wurde für WB validiert. Er ist geeignet, SLBP in Proben von Human, Hund und Zebrafisch (Danio rerio) zu detektieren.

Kurzübersicht für SLBP Antikörper (ABIN633212)

Target: SLBP (Stem-Loop Binding Protein (SLBP))

Reaktivität: Human, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLBP Antikörper

Aufreinigung: Affinity purified

Immunogen: SLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLBP Blocking Peptide, (ABIN939470), is also available for use as a blocking control in assays to test for specificity of this SLBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLBP

Target: SLBP (Stem-Loop Binding Protein (SLBP))

Andere Bezeichnung: SLBP

Hintergrund: SLBP binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.

Molekulargewicht: 30 kDa (MW of target protein)