RENT1/UPF1 Antikörper

Produktnummer ABIN633191

Der Kaninchen Polyklonal Anti-RENT1/UPF1 Antikörper wurde für WB validiert. Er ist geeignet, RENT1/UPF1 in Proben von Human zu detektieren.

Kurzübersicht für RENT1/UPF1 Antikörper (ABIN633191)

Target: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RENT1/UPF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RENT1/UPF1 Antikörper

Aufreinigung: Affinity purified

Immunogen: UPF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UPF1 Blocking Peptide, (ABIN5616919), is also available for use as a blocking control in assays to test for specificity of this UPF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RENT1/UPF1

Target: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Andere Bezeichnung: UPF1

Hintergrund: UPF1 is a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons.

Molekulargewicht: 123 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom