-
- Target Alle RENT1/UPF1 (UPF1) Antikörper anzeigen
- RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RENT1/UPF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UPF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG
- Top Product
- Discover our top product UPF1 Primärantikörper
-
anti-UPF1 Regulator of Nonsense Transcripts Homolog (UPF1) (AA 270-370) antibody
UPF1 Reaktivität: Human WB, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-UPF1 Regulator of Nonsense Transcripts Homolog (UPF1) (AA 270-370) antibodyUPF1 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-UPF1 Regulator of Nonsense Transcripts Homolog (UPF1) antibodyUPF1 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-UPF1 Regulator of Nonsense Transcripts Homolog (UPF1) antibodyUPF1 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-UPF1 Regulator of Nonsense Transcripts Homolog (UPF1) (AA 578-614), (Middle Region) antibodyUPF1 Reaktivität: Human, Maus, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-UPF1 Regulator of Nonsense Transcripts Homolog (UPF1) (AA 301-450) antibodyUPF1 Reaktivität: Human ELISA, IF (cc), IF (p), IHC (p), ICC, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-UPF1 Regulator of Nonsense Transcripts Homolog (UPF1) (AA 583-612) antibodyUPF1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB8354 unconjugated
anti-UPF1 Regulator of Nonsense Transcripts Homolog (UPF1) (AA 7-37), (N-Term) antibodyUPF1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB8018 unconjugated
anti-UPF1 Regulator of Nonsense Transcripts Homolog (UPF1) (AA 1019-1116) antibodyUPF1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4G3 unconjugated
anti-UPF1 Regulator of Nonsense Transcripts Homolog (UPF1) (AA 956-1125) antibodyUPF1 Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UPF1 Blocking Peptide, catalog no. 33R-7945, is also available for use as a blocking control in assays to test for specificity of this UPF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))
- Andere Bezeichnung
- UPF1 (UPF1 Produkte)
- Hintergrund
- UPF1 is a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons.
- Molekulargewicht
- 123 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-
Sie sind hier:
