NBEAL1 Antikörper (N-Term)

Produktnummer ABIN633188

Produktdetails anti-NBEAL1 Antikörper

Target: NBEAL1 (Neurobeachin-Like 1 (NBEAL1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NBEAL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NBEAL1 antibody was raised against the N terminal of NBEAL1

Aufreinigung: Affinity purified

Immunogen: NBEAL1 antibody was raised using the N terminal of NBEAL1 corresponding to a region with amino acids KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NBEAL1 Blocking Peptide, catalog no. 33R-4298, is also available for use as a blocking control in assays to test for specificity of this NBEAL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NBEAL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NBEAL1

Target: NBEAL1 (Neurobeachin-Like 1 (NBEAL1))

Andere Bezeichnung: NBEAL1 (NBEAL1 Produkte)

Synonyme: A530083I02Rik antikoerper, ALS2CR16 antikoerper, ALS2CR17 antikoerper, neurobeachin like 1 antikoerper, NBEAL1 antikoerper

Hintergrund: NBEAL1 belongs to the WD repeat neurobeachin family. It contains 1 BEACH domain and 2 WD repeats. NBEAL1 is highly expressed in brain, kidney, prostate and testis and weakly expressed in ovary, small intestine, colon and peripheral blood leukocytes. It may be correlative to several tumors, such as ovary serous adenocarcinoma and metastasis mammary gland carcinoma breast.

Molekulargewicht: 153 kDa (MW of target protein)