RECQL5 Antikörper (Middle Region)

Produktnummer ABIN633185

Der Kaninchen Polyklonal anti-RECQL5 Antikörper wird verwendet zum Nachweis von RECQL5 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für RECQL5 Antikörper (Middle Region) (ABIN633185)

Target: RECQL5 (RecQ Protein-Like 5 (RECQL5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RECQL5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RECQL5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RecQL5 antibody was raised against the middle region of RECQL5

Aufreinigung: Affinity purified

Immunogen: RecQL5 antibody was raised using the middle region of RECQL5 corresponding to a region with amino acids CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RecQL5 Blocking Peptide, (ABIN937047), is also available for use as a blocking control in assays to test for specificity of this RecQL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RECQL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RECQL5

Target: RECQL5 (RecQ Protein-Like 5 (RECQL5))

Andere Bezeichnung: RecQL5

Hintergrund: RECQL5 may have an important role in DNA metabolism.

Molekulargewicht: 109 kDa (MW of target protein)