Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

PURB Antikörper (N-Term)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PURB in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.
Produktnummer ABIN633184

Kurzübersicht für PURB Antikörper (N-Term) (ABIN633184)

Target

Alle PURB Antikörper anzeigen
PURB (Purine-Rich Element Binding Protein B (PURB))

Reaktivität

  • 10
  • 4
  • 4
  • 3
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
Human, Maus, Ratte

Wirt

  • 9
  • 1
Kaninchen

Klonalität

  • 9
  • 1
Polyklonal

Konjugat

  • 10
Dieser PURB Antikörper ist unkonjugiert

Applikation

  • 7
  • 3
  • 2
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    PURB antibody was raised against the N terminal of PURB

    Aufreinigung

    Affinity purified

    Immunogen

    PURB antibody was raised using the N terminal of PURB corresponding to a region with amino acids MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    PURB Blocking Peptide, (ABIN5615680), is also available for use as a blocking control in assays to test for specificity of this PURB antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PURB antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    PURB (Purine-Rich Element Binding Protein B (PURB))

    Andere Bezeichnung

    PURB

    Hintergrund

    This gene product is a sequence-specific, single-stranded DNA-binding protein.

    Molekulargewicht

    33 kDa (MW of target protein)
Sie sind hier:
Chat with us!