CHRNA1 Antikörper
-
- Target Alle CHRNA1 Antikörper anzeigen
- CHRNA1 (Acetylcholine Receptor Subunit alpha (CHRNA1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHRNA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CHRNA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNV
- Top Product
- Discover our top product CHRNA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHRNA1 Blocking Peptide, catalog no. 33R-9265, is also available for use as a blocking control in assays to test for specificity of this CHRNA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHRNA1 (Acetylcholine Receptor Subunit alpha (CHRNA1))
- Andere Bezeichnung
- CHRNA1 (CHRNA1 Produkte)
- Hintergrund
- The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 CHRNA1 encodes an alpha subunit that plays a role in acetlycholine binding/channel gating.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-