NAA15 Antikörper (Middle Region)

Produktnummer ABIN633171

Dieses Anti-NAA15-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NAA15 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für NAA15 Antikörper (Middle Region) (ABIN633171)

Target: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NAA15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NAA15 Antikörper

Bindungsspezifität: Middle Region

Spezifität: NARG1 antibody was raised against the middle region of NARG1

Aufreinigung: Affinity purified

Immunogen: NARG1 antibody was raised using the middle region of NARG1 corresponding to a region with amino acids PPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NARG1 Blocking Peptide, (ABIN5614917), is also available for use as a blocking control in assays to test for specificity of this NARG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NAA15

Target: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Andere Bezeichnung: NARG1

Hintergrund: The ARD1A-NARG1 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. NARG1 is required to control retinal neovascularization in adult ocular endothelial cells. In complex with G22P1 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.

Molekulargewicht: 101 kDa (MW of target protein)