TNNI3 Antikörper

Produktnummer ABIN633170

Der Kaninchen Polyklonal Anti-TNNI3-Antikörper wurde für WB validiert. Er ist geeignet, TNNI3 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für TNNI3 Antikörper (ABIN633170)

Target: TNNI3 (Cardiac Troponin I (TNNI3))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNNI3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TNNI3 Antikörper

Aufreinigung: Affinity purified

Immunogen: Troponin I Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Troponin I Type 3 Blocking Peptide, (ABIN5616804), is also available for use as a blocking control in assays to test for specificity of this Troponin I Type 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TNNI3

Target: TNNI3 (Cardiac Troponin I (TNNI3))

Hintergrund: Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit, blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. TNNI3 is the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues.

Molekulargewicht: 23 kDa (MW of target protein)