RBM11 Antikörper (Middle Region)

Produktnummer ABIN633164

Produktdetails anti-RBM11 Antikörper

Target: RBM11 (RNA Binding Motif Protein 11 (RBM11))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBM11 antibody was raised against the middle region of RBM11

Aufreinigung: Affinity purified

Immunogen: RBM11 antibody was raised using the middle region of RBM11 corresponding to a region with amino acids SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM11 Blocking Peptide, catalog no. 33R-8611, is also available for use as a blocking control in assays to test for specificity of this RBM11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM11

Target: RBM11 (RNA Binding Motif Protein 11 (RBM11))

Andere Bezeichnung: RBM11 (RBM11 Produkte)

Hintergrund: The function of the protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 19 kDa (MW of target protein)