PAGE4 Antikörper

Produktnummer ABIN633161

Der Kaninchen Polyklonal Anti-PAGE4-Antikörper wurde für WB validiert. Er ist geeignet, PAGE4 in Proben von Human zu detektieren.

Kurzübersicht für PAGE4 Antikörper (ABIN633161)

Target: PAGE4 (P Antigen Family, Member 4 (Prostate Associated) (PAGE4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAGE4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PAGE4 Antikörper

Aufreinigung: Affinity purified

Immunogen: PAGE4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAGE4 Blocking Peptide, (ABIN5615193), is also available for use as a blocking control in assays to test for specificity of this PAGE4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAGE4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAGE4

Target: PAGE4 (P Antigen Family, Member 4 (Prostate Associated) (PAGE4))

Andere Bezeichnung: PAGE4

Hintergrund: This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens.

Molekulargewicht: 11 kDa (MW of target protein)