FHIT Antikörper (Middle Region)

Produktnummer ABIN633160

Produktdetails anti-FHIT Antikörper

Target: FHIT (Fragile Histidine Triad (FHIT))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FHIT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FHIT antibody was raised against the middle region of FHIT

Aufreinigung: Affinity purified

Immunogen: FHIT antibody was raised using the middle region of FHIT corresponding to a region with amino acids VHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FHIT Blocking Peptide, catalog no. 33R-9585, is also available for use as a blocking control in assays to test for specificity of this FHIT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FHIT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FHIT

Target: FHIT (Fragile Histidine Triad (FHIT))

Andere Bezeichnung: FHIT (FHIT Produkte)

Synonyme: AP3Aase antikoerper, FRA3B antikoerper, FHIT antikoerper, zgc:73176 antikoerper, AW045638 antikoerper, Fra14A2 antikoerper, LOC100223655 antikoerper, fragile histidine triad antikoerper, fragile histidine triad gene antikoerper, fragile histidine triad protein antikoerper, fragile histidine triad L homeolog antikoerper, FHIT antikoerper, Fhit antikoerper, fhit antikoerper, PY07476 antikoerper, fhit.L antikoerper

Hintergrund: This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene.

Molekulargewicht: 17 kDa (MW of target protein)