NOG Antikörper (Middle Region)
-
- Target Alle NOG Antikörper anzeigen
- NOG (Noggin (NOG))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NOG Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Noggin antibody was raised against the middle region of NOG
- Aufreinigung
- Affinity purified
- Immunogen
- Noggin antibody was raised using the middle region of NOG corresponding to a region with amino acids GGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEI
- Top Product
- Discover our top product NOG Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Noggin Blocking Peptide, catalog no. 33R-3286, is also available for use as a blocking control in assays to test for specificity of this Noggin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOG (Noggin (NOG))
- Andere Bezeichnung
- Noggin (NOG Produkte)
- Synonyme
- SYM1 antikoerper, SYNS1 antikoerper, nog-A antikoerper, nog1 antikoerper, noggin-1 antikoerper, noggin antikoerper, noggin antikoerper, noggin L homeolog antikoerper, noggin protein antikoerper, NOG antikoerper, Nog antikoerper, nog.L antikoerper, noggin antikoerper
- Hintergrund
- The secreted polypeptide, encoded by this gene, binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). By diffusing through extracellular matrices more efficiently than members of the TGF-beta superfamily, this protein may have a principal role in creating morphogenic gradients.
- Molekulargewicht
- 24 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance, Tube Formation
-