UNQ1887 (Middle Region) Antikörper

Produktnummer ABIN633151

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch UNQ1887 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für UNQ1887 (Middle Region) Antikörper (ABIN633151)

Target: UNQ1887

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: Middle Region

Spezifität: UNQ1887 antibody was raised against the middle region of UNQ1887

Aufreinigung: Affinity purified

Immunogen: UNQ1887 antibody was raised using the middle region of UNQ1887 corresponding to a region with amino acids VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UNQ1887 Blocking Peptide, (ABIN5616916), is also available for use as a blocking control in assays to test for specificity of this UNQ1887 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNQ1887 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: UNQ1887

Hintergrund: UNQ1887 may act as intramembrane protease.

Molekulargewicht: 42 kDa (MW of target protein)