FAM3D Antikörper (Middle Region)

Produktnummer ABIN633145

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FAM3D in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für FAM3D Antikörper (Middle Region) (ABIN633145)

Target: FAM3D (Family with Sequence Similarity 3, Member D (FAM3D))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM3D Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM3D Antikörper

Bindungsspezifität: Middle Region

Spezifität: FAM3 D antibody was raised against the middle region of FAM3

Aufreinigung: Affinity purified

Immunogen: FAM3 D antibody was raised using the middle region of FAM3 corresponding to a region with amino acids LVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM3D Blocking Peptide, (ABIN5613485), is also available for use as a blocking control in assays to test for specificity of this FAM3D antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM3D

Target: FAM3D (Family with Sequence Similarity 3, Member D (FAM3D))

Andere Bezeichnung: FAM3D

Hintergrund: The function of FAM3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 25 kDa (MW of target protein)