SAAL1 Antikörper (N-Term)

Produktnummer ABIN633143

Produktdetails anti-SAAL1 Antikörper

Target: SAAL1 (serum Amyloid A-Like 1 (SAAL1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAAL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SAAL1 antibody was raised against the N terminal of SAAL1

Aufreinigung: Affinity purified

Immunogen: SAAL1 antibody was raised using the N terminal of SAAL1 corresponding to a region with amino acids MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SAAL1 Blocking Peptide, catalog no. 33R-5867, is also available for use as a blocking control in assays to test for specificity of this SAAL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAAL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SAAL1

Target: SAAL1 (serum Amyloid A-Like 1 (SAAL1))

Andere Bezeichnung: SAAL1 (SAAL1 Produkte)

Synonyme: SPACIA1 antikoerper, 5031425D22Rik antikoerper, zgc:55505 antikoerper, serum amyloid A like 1 antikoerper, serum amyloid A-like 1 antikoerper, SAAL1 antikoerper, Saal1 antikoerper, saal1 antikoerper

Hintergrund: The SAAL1 protein may be involved in binding.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom