C3orf49 Antikörper (Middle Region)

Produktnummer ABIN633142

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch C3orf49 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für C3orf49 Antikörper (Middle Region) (ABIN633142)

Target: C3orf49 (Chromosome 3 Open Reading Frame 49 (C3orf49))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C3orf49 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C3orf49 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C3 orf49 antibody was raised against the middle region of C3 rf49

Aufreinigung: Affinity purified

Immunogen: C3 orf49 antibody was raised using the middle region of C3 rf49 corresponding to a region with amino acids IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C3orf49 Blocking Peptide, (ABIN939501), is also available for use as a blocking control in assays to test for specificity of this C3orf49 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf49 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C3orf49

Target: C3orf49 (Chromosome 3 Open Reading Frame 49 (C3orf49))

Andere Bezeichnung: C3orf49

Hintergrund: The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 33 kDa (MW of target protein)