NT5DC2 Antikörper (N-Term)

Produktnummer ABIN633138

Produktdetails anti-NT5DC2 Antikörper

Target: NT5DC2 (5'-Nucleotidase Domain Containing 2 (NT5DC2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NT5DC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NT5 DC2 antibody was raised against the N terminal of NT5 C2

Aufreinigung: Affinity purified

Immunogen: NT5 DC2 antibody was raised using the N terminal of NT5 C2 corresponding to a region with amino acids IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NT5DC2 Blocking Peptide, catalog no. 33R-4135, is also available for use as a blocking control in assays to test for specificity of this NT5DC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 C2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NT5DC2

Target: NT5DC2 (5'-Nucleotidase Domain Containing 2 (NT5DC2))

Andere Bezeichnung: NT5DC2 (NT5DC2 Produkte)

Synonyme: 2510015F01Rik antikoerper, RGD1305524 antikoerper, MGC83840 antikoerper, im:6907673 antikoerper, wu:fb83e03 antikoerper, wu:fe11h11 antikoerper, zgc:153357 antikoerper, 5'-nucleotidase domain containing 2 antikoerper, 5'-nucleotidase domain containing 2 b antikoerper, NT5DC2 antikoerper, Nt5dc2 antikoerper, nt5dc2.S antikoerper, nt5dc2 antikoerper, nt5dc2-b antikoerper

Hintergrund: The NT5DC2 protein may be involved in hydrolase activity and metal ion binding.

Molekulargewicht: 61 kDa (MW of target protein)