NT5DC2 Antikörper (N-Term)

Produktnummer ABIN633138

Dieses Anti-NT5DC2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NT5DC2 in WB. Geeignet für Human.

Kurzübersicht für NT5DC2 Antikörper (N-Term) (ABIN633138)

Target: NT5DC2 (5'-Nucleotidase Domain Containing 2 (NT5DC2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NT5DC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NT5DC2 Antikörper

Bindungsspezifität: N-Term

Spezifität: NT5 DC2 antibody was raised against the N terminal of NT5 C2

Aufreinigung: Affinity purified

Immunogen: NT5 DC2 antibody was raised using the N terminal of NT5 C2 corresponding to a region with amino acids IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NT5DC2 Blocking Peptide, (ABIN939521), is also available for use as a blocking control in assays to test for specificity of this NT5DC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 C2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NT5DC2

Target: NT5DC2 (5'-Nucleotidase Domain Containing 2 (NT5DC2))

Andere Bezeichnung: NT5DC2

Hintergrund: The NT5DC2 protein may be involved in hydrolase activity and metal ion binding.

Molekulargewicht: 61 kDa (MW of target protein)