C8orf45 Antikörper (Middle Region)

Produktnummer ABIN633137

Der Kaninchen Polyklonal Anti-C8orf45-Antikörper wurde für WB validiert. Er ist geeignet, C8orf45 in Proben von Human zu detektieren.

Kurzübersicht für C8orf45 Antikörper (Middle Region) (ABIN633137)

Target: C8orf45 (Chromosome 8 Open Reading Frame 45 (C8orf45))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C8orf45 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C8orf45 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C8 orf45 antibody was raised against the middle region of C8 rf45

Aufreinigung: Affinity purified

Immunogen: C8 orf45 antibody was raised using the middle region of C8 rf45 corresponding to a region with amino acids IQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C8orf45 Blocking Peptide, (ABIN939493), is also available for use as a blocking control in assays to test for specificity of this C8orf45 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf45 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C8orf45

Target: C8orf45 (Chromosome 8 Open Reading Frame 45 (C8orf45))

Andere Bezeichnung: C8orf45

Hintergrund: The function of Chromosome 8 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 65 kDa (MW of target protein)