ANKRD54 Antikörper (Middle Region)

Produktnummer ABIN633128

Der Kaninchen Polyklonal anti-ANKRD54 Antikörper wird verwendet zum Nachweis von ANKRD54 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für ANKRD54 Antikörper (Middle Region) (ABIN633128)

Target: ANKRD54 (Ankyrin Repeat Domain 54 (ANKRD54))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANKRD54 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ANKRD54 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ANKRD54 antibody was raised against the middle region of ANKRD54

Aufreinigung: Affinity purified

Immunogen: ANKRD54 antibody was raised using the middle region of ANKRD54 corresponding to a region with amino acids EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANKRD54 Blocking Peptide, (ABIN938174), is also available for use as a blocking control in assays to test for specificity of this ANKRD54 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD54 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANKRD54

Target: ANKRD54 (Ankyrin Repeat Domain 54 (ANKRD54))

Andere Bezeichnung: ANKRD54

Hintergrund: ANKRD54 is involved in protein complex binding and protein kinase regulator activity.

Molekulargewicht: 32 kDa (MW of target protein)