FAM118A Antikörper (Middle Region)
-
- Target Alle FAM118A Produkte
- FAM118A (Family with Sequence Similarity 118, Member A (FAM118A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM118A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM118 A antibody was raised against the middle region of FAM118
- Aufreinigung
- Affinity purified
- Immunogen
- FAM118 A antibody was raised using the middle region of FAM118 corresponding to a region with amino acids EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM118A Blocking Peptide, catalog no. 33R-2802, is also available for use as a blocking control in assays to test for specificity of this FAM118A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM118A (Family with Sequence Similarity 118, Member A (FAM118A))
- Andere Bezeichnung
- FAM118A (FAM118A Produkte)
- Synonyme
- C22orf8 antikoerper, 3110048E14Rik antikoerper, C230014M12Rik antikoerper, family with sequence similarity 118 member A antikoerper, family with sequence similarity 118, member A antikoerper, FAM118A antikoerper, Fam118a antikoerper
- Hintergrund
- The function of FAM118 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 40 kDa (MW of target protein)
-