FAM118A Antikörper (Middle Region)

Produktnummer ABIN633127

Produktdetails anti-FAM118A Antikörper

Target: FAM118A (Family with Sequence Similarity 118, Member A (FAM118A))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM118A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM118 A antibody was raised against the middle region of FAM118

Aufreinigung: Affinity purified

Immunogen: FAM118 A antibody was raised using the middle region of FAM118 corresponding to a region with amino acids EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM118A Blocking Peptide, catalog no. 33R-2802, is also available for use as a blocking control in assays to test for specificity of this FAM118A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM118A

Target: FAM118A (Family with Sequence Similarity 118, Member A (FAM118A))

Andere Bezeichnung: FAM118A (FAM118A Produkte)

Synonyme: C22orf8 antikoerper, 3110048E14Rik antikoerper, C230014M12Rik antikoerper, family with sequence similarity 118 member A antikoerper, family with sequence similarity 118, member A antikoerper, FAM118A antikoerper, Fam118a antikoerper

Hintergrund: The function of FAM118 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 40 kDa (MW of target protein)