TACC3 Antikörper (Middle Region)

Produktnummer ABIN633120

Dieser Anti-TACC3-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von TACC3 in WB. Geeignet für Human.

Kurzübersicht für TACC3 Antikörper (Middle Region) (ABIN633120)

Target: TACC3 (Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TACC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TACC3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TACC3 antibody was raised against the middle region of TACC3

Aufreinigung: Affinity purified

Immunogen: TACC3 antibody was raised using the middle region of TACC3 corresponding to a region with amino acids PGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKES

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TACC3 Blocking Peptide, (ABIN5616492), is also available for use as a blocking control in assays to test for specificity of this TACC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TACC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TACC3

Target: TACC3 (Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3))

Andere Bezeichnung: TACC3

Hintergrund: The function of this gene has not yet been determined, however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice.

Molekulargewicht: 90 kDa (MW of target protein)

Pathways: Maintenance of Protein Location