RAPGEF3 Antikörper

Produktnummer ABIN633118

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch RAPGEF3 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für RAPGEF3 Antikörper (ABIN633118)

Target: RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAPGEF3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAPGEF3 Antikörper

Aufreinigung: Affinity purified

Immunogen: RAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAPGEF3 Blocking Peptide, (ABIN5615758), is also available for use as a blocking control in assays to test for specificity of this RAPGEF3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAPGEF3

Target: RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))

Andere Bezeichnung: RAPGEF3

Hintergrund: RAPGEF3 is a guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP.

Molekulargewicht: 99 kDa (MW of target protein)

Pathways: cAMP Metabolic Process