EFCAB3 Antikörper (N-Term)

Produktnummer ABIN633117

Dieses Anti-EFCAB3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von EFCAB3 in WB. Geeignet für Human.

Kurzübersicht für EFCAB3 Antikörper (N-Term) (ABIN633117)

Target: EFCAB3 (EF-Hand Calcium Binding Domain 3 (EFCAB3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EFCAB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EFCAB3 Antikörper

Bindungsspezifität: N-Term

Spezifität: EFCAB3 antibody was raised against the N terminal of EFCAB3

Aufreinigung: Affinity purified

Immunogen: EFCAB3 antibody was raised using the N terminal of EFCAB3 corresponding to a region with amino acids MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EFCAB3 Blocking Peptide, (ABIN5613310), is also available for use as a blocking control in assays to test for specificity of this EFCAB3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFCAB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EFCAB3

Target: EFCAB3 (EF-Hand Calcium Binding Domain 3 (EFCAB3))

Andere Bezeichnung: EFCAB3

Hintergrund: The function of the protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 50 kDa (MW of target protein)