CCDC146 Antikörper (Middle Region)

Produktnummer ABIN633113

Der Kaninchen Polyklonal anti-CCDC146 Antikörper wird verwendet zum Nachweis von CCDC146 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CCDC146 Antikörper (Middle Region) (ABIN633113)

Target: CCDC146 (Coiled-Coil Domain Containing 146 (CCDC146))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC146 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCDC146 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CCDC146 antibody was raised against the middle region of CCDC146

Aufreinigung: Affinity purified

Immunogen: CCDC146 antibody was raised using the middle region of CCDC146 corresponding to a region with amino acids KEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC146 Blocking Peptide, (ABIN939723), is also available for use as a blocking control in assays to test for specificity of this CCDC146 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC146 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC146

Target: CCDC146 (Coiled-Coil Domain Containing 146 (CCDC146))

Andere Bezeichnung: CCDC146

Hintergrund: The function of CCDC146 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 113 kDa (MW of target protein)